PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1598410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRAS
Protein Properties Length: 553aa    MW: 63120 Da    PI: 6.9389
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1598410.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2813.5e-861825512374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalklfsevsPil 91 
                       +lLl++Ae vs +++e+a+ lL++ + ++  +g+++qR++++f++AL++r++++  ++ k    + ++ ++     +  ++++ l ++  P++
  Lj5g3v1598410.1 182 AQLLLAAAERVSCQQFERASFLLQNFQGNSPHHGSAVQRVIFHFAQALQERINKENGTTLKGSDERVKE-RHlielLEVDTNITILCHQKMPFY 274
                      699***************************************************666666555444444.33244444445555569999**** PP

             GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                      ++ +++  qaIle v++ +++H i ++i+ G+    L+qaL++R+e+p   l+iT+vg     +k+++eetg+rL +fAe+l++pf++n++ ++
  Lj5g3v1598410.1 275 QVMQFAGVQAILENVASGTKIHLININIGCGVMCTGLMQALSERQENPVeILKITAVGV---ANKTKIEETGKRLMSFAESLNLPFSYNMIFVT 365
                      *********************************************666549********...579***************************** PP

             GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                      ++ ++++e+++v+ +Ea+aV + + l +l+++s sle+    ++k++++++P++++    ea+hns+sF++rf+eal yysa fd+l++ + +e
  Lj5g3v1598410.1 366 DMMEIKVEQFDVEDDEAVAVYSPYFLRSLVSDSDSLEN----LMKVLRKIKPNIMINLGVEANHNSPSFVNRFVEALFYYSAYFDCLDTCMKEE 455
                      ******************************99999999....**************************************************** PP

             GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvS 371
                      +e r+ +E++ l+++i+n+va+e +er+ r  +   Wr+ + +  + + +lse+a+ qa+l+ +k++ ++  +++++ ++l++gWk+ p+ s+S
  Lj5g3v1598410.1 456 HECRMRIEEM-LSEKIRNIVAMEDRERTVRSVKIDVWRRFFARYRMVETRLSESAVYQANLVAKKFAcGNSCTIDKNGKCLLIGWKGTPIHSIS 548
                      **********.********************************************************9999*********************** PP

             GRAS 372 aWr 374
                      aW+
  Lj5g3v1598410.1 549 AWK 551
                      **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.262155530IPR005202Transcription factor GRAS
PfamPF035141.2E-83182551IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MQLLGGLTNT SNPPPTTEHE KEDHFSKEQN QQQQQQHDHF SFDNLMFQDF YFEPALEPKA  60
AFQEPKEQKN RGVESSQFFG FNKHLVGSNK QVPPSSLASL DLLKNYGSRF KRPRGQNILS  120
KTKTCASPLK LSTEDILRVA GARFIQHSSS TQWQDNLCTP MHPYANGFSG FSEEEIKDIE  180
LAQLLLAAAE RVSCQQFERA SFLLQNFQGN SPHHGSAVQR VIFHFAQALQ ERINKENGTT  240
LKGSDERVKE RHLIELLEVD TNITILCHQK MPFYQVMQFA GVQAILENVA SGTKIHLINI  300
NIGCGVMCTG LMQALSERQE NPVEILKITA VGVANKTKIE ETGKRLMSFA ESLNLPFSYN  360
MIFVTDMMEI KVEQFDVEDD EAVAVYSPYF LRSLVSDSDS LENLMKVLRK IKPNIMINLG  420
VEANHNSPSF VNRFVEALFY YSAYFDCLDT CMKEEHECRM RIEEMLSEKI RNIVAMEDRE  480
RTVRSVKIDV WRRFFARYRM VETRLSESAV YQANLVAKKF ACGNSCTIDK NGKCLLIGWK  540
GTPIHSISAW KFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-3220455126375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061370.0AP006137.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT37K17, TM0239, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591395.10.0GRAS family transcription factor
TrEMBLA0A0L9TYS20.0A0A0L9TYS2_PHAAN; Uncharacterized protein
STRINGGLYMA03G37851.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-46RGA-like 1